PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe5G119500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family WOX
Protein Properties Length: 302aa    MW: 33915.5 Da    PI: 5.126
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe5G119500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.53.1e-20123183257
                        T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
           Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                        r+R+t+t+ ql++Le  F + + +ps++++++++++l     ++e++V++WFqNrRa+ k+
  Aqcoe5G119500.1.p 123 RQRWTPTPMQLQILEHIFDQgTGTPSKQKIKDITNELtqhgPISETNVYNWFQNRRARSKR 183
                        89*****************99*******************99*****************97 PP

2Wus_type_Homeobox100.51.2e-32122185265
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        +r+RWtPtp Q++iLe+++++G+ tP+k++i++it+eL+++G i+++NV++WFQNr+aR+++kq
  Aqcoe5G119500.1.p 122 TRQRWTPTPMQLQILEHIFDQGTGTPSKQKIKDITNELTQHGPISETNVYNWFQNRRARSKRKQ 185
                        689***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.3E-16117186IPR009057Homeodomain-like
PROSITE profilePS5007114.382119184IPR001356Homeobox domain
SMARTSM003893.0E-13121188IPR001356Homeobox domain
SuperFamilySSF466895.56E-17122185IPR009057Homeodomain-like
PfamPF000465.1E-18123183IPR001356Homeobox domain
CDDcd000865.04E-12123185No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MDLSRNVLSK VQLRGGGGGG EGIEEEEEEQ QQQVRLMDWE KQQQQQQESG SSSSGIGLMY  60
VKVMTDEQME LLRKQISIYA TICEQLVEMH KAITSQQDFA GMRLGNVYFD PLTTSTGHKI  120
STRQRWTPTP MQLQILEHIF DQGTGTPSKQ KIKDITNELT QHGPISETNV YNWFQNRRAR  180
SKRKQHGPAT NNGESEVETE VESPKEKRAK PENFQLNENH ALREDEICFQ SSGRSSELHS  240
LDQSDKGEST FPSDGCSKSS GSLGHVSFYD TVLANPRIDH LLGKMELPGG YNPYQQGDGY  300
D*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1176184RRARSKRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00669PBMTransfer from GRMZM2G038252Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010270477.11e-125PREDICTED: WUSCHEL-related homeobox 8-like
SwissprotQ5QMM35e-95WOX8_ORYSJ; WUSCHEL-related homeobox 8
TrEMBLA0A0J8C4W71e-120A0A0J8C4W7_BETVU; Uncharacterized protein
STRINGVIT_18s0122g01140.t011e-118(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35550.14e-84WUSCHEL related homeobox 13